General Information

  • ID:  hor003184
  • Uniprot ID:  A0A7M7IPT4
  • Protein name:  RYamide-7
  • Gene name:  107980750
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SEGHKNPKELPKFFEIKPRVDQFFIGSRY
  • Length:  29(182-210)
  • Propeptide:  MISSSRKIRRVSDYLKLDKLIVWLWISGIFLTLVSSQDNFYASGRFGKRKYALSMSQIPLCSKFDRSEDRSAGNSLKDSSLFSSARFGRSEDRNTGNSLRDSSSFFPARYGRSEDRSTGNSLRDSSSFFPARFGRSEDRSTGNSLKDSSSFSPARYGRSEDRSSGNSLKESSFFSPGRYGRSEGHKNPKELPKFFEIKPRVDQFFIGSRYGKRSLSMLEPQPPLEALHNQRFEAAIDYLDRIKQNLAEAEEIEDE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7IPT4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003184_AF2.pdbhor003184_ESM.pdb

Physical Information

Mass: 399458 Formula: C163H245N43O43
Absent amino acids: ACMTW Common amino acids: FK
pI: 10.02 Basic residues: 7
Polar residues: 6 Hydrophobic residues: 8
Hydrophobicity: -100.34 Boman Index: -7237
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.34
Instability Index: 2488.28 Extinction Coefficient cystines: 1490
Absorbance 280nm: 53.21

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis